missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DMC1 Partial ORF (NP_008999, 237 a.a. - 339 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
The protein encoded by this gene is essential for meiotic homologous recombination. Genetic recombination in meiosis plays an important role in generating diversity of genetic information. The product of this gene is structurally and evolutionary related to the products of the yeast RAD51 and E. coli RecA genes. Alternative splice variants of this gene have been described but their full-length nature has not been determined. [provided by RefSeq]
Sequence: GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Spezifikation
Spezifikation
Zugriffsnummer | NP_008999 |
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 11144 |
Molekulargewicht | 37.07kDa |
Name | DMC1 (Human) Recombinant Protein (Q01) |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 25 μg |
Immunogen | GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK |
Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mehr anzeigen |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Human DMC1 Partial ORF (NP_008999, 237 a.a. - 339 a.a.) Recombinant Protein with GST-tag at N-terminal >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur