missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DIAPH3 Partial ORF (NP_112194, 632 a.a. - 729 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00081624-Q01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16150407

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
09-01-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: PDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKV
Spezifikation

Spezifikation

NP_112194
Liquid
81624
DIAPH3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434C0931|DKFZp686A13178|DRF3|Dia2|FLJ34705|diap3
DIAPH3
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKV
RUO
DIAPH3
wheat germ expression system
Yes
Videos
Dokumentation