missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CYFIP1 Partial ORF (NP_055423.1, 735 a.a. - 819 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00023191-Q01S
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Sequence: GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDSpezifikation
NP_055423.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.09kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLD | |
RUO | |
CYFIP1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
23191 | |
CYFIP1 (Human) Recombinant Protein (Q01) | |
10 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ45151/P140SRA-1/SHYC/SRA1 | |
CYFIP1 | |
Recombinant | |
wheat germ expression system |