missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CRKL Partial ORF (NP_005198, 204 a.a. - 303 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 µg
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic
Sequence: AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Spezifikation
Spezifikation
Zugriffsnummer | NP_005198 |
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 1399 |
Molekulargewicht | 36.74kDa |
Name | CRKL (Human) Recombinant Protein (Q01) |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 25 ug |
Immunogen | AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE |
Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mehr anzeigen |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Human CRKL Partial ORF (NP_005198, 204 a.a. - 303 a.a.) Recombinant Protein with GST-tag at N-terminal >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur