Learn More
Invitrogen™ Human Citrate Synthase (aa 38-137) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP97646
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83420 (PA5-83420. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citrate from oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metabolism. This protein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found.
Spezifikation
O75390 | |
Blocking Assay, Control | |
1431 | |
100 μL | |
2610511A05Rik; 9030605P22Rik; Ahl4; BB234005; Cis; citrate (Si)-synthase; citrate synthase; citrate synthase precursor (EC 4.1.3.7); citrate synthase, mitochondrial; citrate synthetase; Cs; wu:fb58e04; zgc:55507 | |
CS | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Citrate Synthase (aa 38-137) Control Fragment | |
RUO | |
Citrate Synthase | |
Unconjugated | |
Recombinant | |
ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.