missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CIDEC Partial ORF (NP_071377.2, 53 a.a. - 141 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00063924-Q01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16129486

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 30-06-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

DNA fragmentation factor (DFF) induces the fragmentation of DNA associated with apoptosis. A novel family of cell death-inducing DFF45 (MIM 601882)-like effectors (CIDEs), including CIDEC, can also promote apoptosis (Liang et al., 2003 [PubMed 12429024]).[supplied by OMIM]

Sequence: SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Spezifikation

Spezifikation

NP_071377.2
Liquid
63924
CIDEC (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CIDE-3/FLJ20871/Fsp27
CIDEC
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
RUO
CIDEC
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote