missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human CIAPIN1 Partial ORF (NP_064709, 266 a.a. - 367 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16128956
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ Human CIAPIN1 Partial ORF (NP_064709, 266 a.a. - 367 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human CIAPIN1 Partial ORF (NP_064709, 266 a.a. - 367 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16128956
25 μg, 25 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
This item is not returnable. View return policy

Artikelnummer. 16128956

Marke: Abnova™ H00057019Q01.25ug

Dieser Artikel wurde eingestellt und ist leider nicht mehr verfügbar. Sehen Sie sich das Produkt an, um alternative Produktvorschläge zu sehen oder kontaktieren Sie unseren Technischen Support unter 056 618 41 11.
 Alternative Produkte anzeigen

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM]

Sequence: DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA

Specifications

Zugriffsnummer NP_064709
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 57019
Molekulargewicht 36.96kDa
Name CIAPIN1 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 μg
Immunogen DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias 2810413N20Rik/Anamorsin/DRE2/PRO0915
Gebräuchliche Bezeichnung CIAPIN1
Gensymbol CIAPIN1
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human CIAPIN1 Partial ORF (NP_064709, 266 a.a. - 367 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.