Learn More
Abnova™ Human CIAPIN1 Partial ORF (NP_064709, 266 a.a. - 367 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00057019-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM]
Sequence: DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDASpezifikation
| NP_064709 | |
| Liquid | |
| 57019 | |
| CIAPIN1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 2810413N20Rik/Anamorsin/DRE2/PRO0915 | |
| CIAPIN1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.96kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA | |
| RUO | |
| CIAPIN1 | |
| Wheat Germ (in vitro) | |
| GST |