Learn More
Abnova™ Human CHRNB2 Partial ORF (NP_000739.1, 26 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal
Beschreibung
Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy. [provided by RefSeq]
Spezifikation
Spezifikation
Zugriffsnummer | NP_000739.1 |
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 1141 |
Molekulargewicht | 37.29kDa |
Name | CHRNB2 (Human) Recombinant Protein (Q01) |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 25 ug |
Immunogen | TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS |
Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mehr anzeigen |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.