missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CGB7 Partial ORF (NP_149133, 56 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00094027-Q01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16131307

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 30-06-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 7 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq]

Sequence: GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
Spezifikation

Spezifikation

NP_149133
Liquid
94027
CGB7 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CG-beta-a/FLJ35403/FLJ43118
CGB7
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
RUO
CGB7
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote