missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CD6 Partial ORF (NP_006716, 308 a.a. - 400 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00000923-Q01.10ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CD6 is a monomeric 105- or 130-kD membrane glycoprotein that is involved in T-cell activation. The size difference between the 2 CD6 forms is due to differences in phosphorylation (Robinson et al., 1995 [PubMed 7589069]).[supplied by OMIM]
Sequence: CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMSpezifikation
| NP_006716 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.97kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM | |
| RUO | |
| CD6 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 923 | |
| CD6 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ44171/TP120 | |
| CD6 | |
| Recombinant | |
| wheat germ expression system |