missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD177 Control Fragment Recombinant Protein

Artikelnummer. 30196011
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30196011

Marke: Invitrogen™ RP109641

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD177 (NB1/HNA-2a and PRV-1 form) is a GPI-anchored glycoprotein present mainly on neutrophils. Its plasma membrane expression is increased during pregnancy and and inflammation or after G-CSF application. Ligand of CD177 has been identified as CD31 (PECAM-1). CD177 participates in neutrophil transmigration and seems to be also a pro-proliferative molecule. The antibodies against CD177 can be involved in neonatal alloimmune neutropenia (NAN).
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q8N6Q3
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 57126
Name Human CD177 Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 1190003K14Rik; CD177; CD177 antigen; CD177 molecule; cell surface receptor; HNA2A; HNA-2 A; Human neutrophil alloantigen 2 A; NB1; NB1 glycoprotein; NB1 GP; Pdp3; Polycythemia rubra vera protein 1; PRV1; PRV-1; RGD1562941; UNQ595/PRO1181
Gebräuchliche Bezeichnung CD177
Gensymbol CD177
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt