missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CBX2 Partial ORF (NP_005180, 374 a.a. - 463 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00084733-Q02.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16150877

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
07-01-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: HATATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLASRAVAPPTPASKRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEE
Spezifikation

Spezifikation

NP_005180
Liquid
84733
CBX2 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CDCA6|M33|MGC10561
CBX2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HATATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLASRAVAPPTPASKRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEE
RUO
CBX2
wheat germ expression system
Yes
Videos
Dokumentation