missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CAPZA3 Partial ORF (NP_201585, 200 a.a. - 299 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00093661-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
Sequence: NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWIISpezifikation
| NP_201585 | |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII | |
| RUO | |
| CAPZA3 | |
| Wheat Germ (in vitro) | |
| GST |
| wheat germ expression system | |
| Liquid | |
| 93661 | |
| CAPZA3 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CAPPA3|Gsg3 | |
| CAPZA3 | |
| Yes |