missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CAPN11 Partial ORF (NP_008989, 557 a.a. - 651 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00011131-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
Calpains constitute a family of intracellular calcium-dependent cysteine proteases. There are eight members in this superfamily. They consist of a variable 80 kDa subunit and an invariant 30 kDa subunit. This calpain protein appears to have protease activity and calcium-binding ability. A similar mouse protein may play a functional role in spermatogenesis and in the regulation of calcium-dependent signal transduction events during meiosis. [provided by RefSeq]
Sequence: LLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARYSpezifikation
| NP_008989 | |
| Liquid | |
| 11131 | |
| CAPN11 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| calpain11 | |
| CAPN11 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.19kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARY | |
| RUO | |
| CAPN11 | |
| Wheat Germ (in vitro) | |
| GST |