Learn More
Invitrogen™ Human CACTIN (aa 550-629) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP98977
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60019 (PA5-60019. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Cactin is a novel negative regulator of TLR signaling and reveals its capacity to target MHC Class III genes at the molecular and functional level. It is localized to the nucleus, which is critical for manifesting its inhibitory effects on TLR signaling. Experimental evidences show overexpression of Cactin suppresses TLR-induced activation of NF-kB and interferon-regulatory factor transcription factors and induction of TLR-responsive genes. It is also reported Cactin interacts with IkB-like protein and targets other proteins that are encoded by genes in the MHC Class III region of chromosome 6.
Spezifikation
Q8WUQ7 | |
Blocking Assay, Control | |
58509 | |
100 μL | |
2510012J08Rik; C19orf29; C20H19orf29; CACTIN; cactin, spliceosome C complex subunit; fSAPc; functional spliceosome-associated protein c; NY REN 24 antigen; NY-REN-24; NY-REN-24 antigen; renal carcinoma antigen NY-REN-24; RGD1563634 | |
CACTIN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CACTIN (aa 550-629) Control Fragment | |
RUO | |
CACTIN | |
Unconjugated | |
Recombinant | |
SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.