missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human C9orf80 Full-length ORF (NP_067041.1, 1 a.a. - 104 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16133083
Verfügbar ab: 02-09-2025
Nur noch null auf Lager
Zum Warenkorb hinzufügen

Abnova™ Human C9orf80 Full-length ORF (NP_067041.1, 1 a.a. - 104 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16133083
10 μg, 10 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Unit Size:
10 Mikrogramm
25 Mikrogramm
This item is not returnable. View return policy

Artikelnummer. 16133083

Marke: Abnova™ H00058493P01.10ug

Nur noch null auf Lager
Verfügbar ab: 02-09-2025
Zum Warenkorb hinzufügen
Nur noch null auf Lager
Zum Warenkorb hinzufügen
This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

Sequence: MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

Specifications

Zugriffsnummer NP_067041.1
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 58493
Molekulargewicht 37.8kDa
Name C9orf80 (Human) Recombinant Protein (P01)
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 μg
Immunogen MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias HSPC043
Gebräuchliche Bezeichnung C9orf80
Gensymbol C9orf80
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human C9orf80 Full-length ORF (NP_067041.1, 1 a.a. - 104 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.