Learn More
Abnova™ Human C6orf206 Full-length ORF (NP_689945.2, 1 a.a. - 276 a.a.) Recombinant Protein with GST-tag at N-terminal
Beschreibung
Radial spokes are regularly spaced along cilia, sperm, and flagella axonemes and have a multisubunit 'stalk' and 'head' that form a signal transduction scaffold between the central microtubule pair and dynein (see MIM 603297) arms. RSPH9 is predicted to be a component of the radial spoke head based on homology with proteins in the biflagellate alga Chlamydomonas reinhardtii and other ciliates (Castleman et al., 2009 [PubMed 19200523]).[supplied by OMIM]
Spezifikation
Spezifikation
Zugriffsnummer | NP_689945.2 |
Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 221421 |
Molekulargewicht | 57.7kDa |
Name | C6orf206 (Human) Recombinant Protein (P01) |
Reinigungsverfahren | Glutathione Sepharose 4 Fast Flow |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 25 μg |
Immunogen | MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML |
Mehr anzeigen |
Produktvorschläge
Customers who viewed this item also viewed.
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.