missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human BTK Partial ORF (NP_000052, 100 a.a. - 189 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00000695-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. [provided by RefSeq]
Sequence: YPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPSpezifikation
| NP_000052 | |
| Liquid | |
| 695 | |
| BTK (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AGMX1/AT/ATK/BPK/IMD1/MGC126261/MGC126262/PSCTK1/XLA | |
| BTK | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.53kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| YPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLP | |
| RUO | |
| BTK | |
| Wheat Germ (in vitro) | |
| GST |