missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human BIRC7 Partial ORF (NP_647478.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16130017

Abnova™ Human BIRC7 Partial ORF (NP_647478.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16130017
25 μg, 25 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16130017

Marke: Abnova™ H00079444Q01.25ug

Dieser Artikel wurde eingestellt und ist leider nicht mehr verfügbar. Sehen Sie sich das Produkt an, um alternative Produktvorschläge zu sehen oder kontaktieren Sie unseren Technischen Support unter 056 618 41 11.
Alternative Produkte anzeigen

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide. [provided by RefSeq]

Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR

Spezifikation

Zugriffsnummer NP_647478.1
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 79444
Molekulargewicht 35.64kDa
Name BIRC7 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 μg
Immunogen MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias KIAP/LIVIN/ML-IAP/MLIAP/RNF50
Gebräuchliche Bezeichnung BIRC7
Gensymbol BIRC7
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human BIRC7 Partial ORF (NP_647478.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt