missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BCAR1 Partial ORF (NP_055382, 771 a.a. - 870 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16150926
25 μg, 25 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Unit Size:
10 Mikrogramm
25 Mikrogramm
This item is not returnable. View return policy
This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

BCAR1, or CAS, is an Src (MIM 190090) family kinase substrate involved in various cellular events, including migration, survival, transformation, and invasion (Sawada et al., 2006 [PubMed 17129785]).[supplied by OMIM]

Sequence: TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA

Specifications

Zugriffsnummer NP_055382
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 9564
Molekulargewicht 36.74kDa
Name BCAR1 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 μg
Immunogen TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias CAS/CAS1/CASS1/CRKAS/P130Cas
Gebräuchliche Bezeichnung BCAR1
Gensymbol BCAR1
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human BCAR1 Partial ORF (NP_055382, 771 a.a. - 870 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.