missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human ATP6V1G2 Full-length ORF (NP_569730.1, 1 a.a. - 118 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16132081
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen

Abnova™ Human ATP6V1G2 Full-length ORF (NP_569730.1, 1 a.a. - 118 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16132081
10 µg, 10 Mikrogramm
Click to view available options
Menge:
10 µg
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16132081

Marke: Abnova™ H00000534P01.10ug

Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c″, and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Sequence: MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

Spezifikation

Zugriffsnummer NP_569730.1
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 534
Molekulargewicht 40kDa
Name ATP6V1G2 (Human) Recombinant Protein (P01)
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 µg
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias ATP6G/ATP6G2/NG38/VMA10
Gebräuchliche Bezeichnung ATP6V1G2
Gensymbol ATP6V1G2
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human ATP6V1G2 Full-length ORF (NP_569730.1, 1 a.a. - 118 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt