missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human ANTXR1 Partial ORF (NP_115584.1, 201 a.a. - 305 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16150657
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen

Abnova™ Human ANTXR1 Partial ORF (NP_115584.1, 201 a.a. - 305 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16150657
10 μg, 10 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16150657

Marke: Abnova™ H00084168Q01.10ug

Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq]

Sequence: VNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMNDGLSF

Spezifikation

Zugriffsnummer NP_115584.1
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 84168
Molekulargewicht 37.29kDa
Name ANTXR1 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 μg
Immunogen VNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMNDGLSF
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias ATR/FLJ10601/FLJ11298/FLJ21776/TEM8
Gebräuchliche Bezeichnung ANTXR1
Gensymbol ANTXR1
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human ANTXR1 Partial ORF (NP_115584.1, 201 a.a. - 305 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt