missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ACTG2 Full-length ORF (NP_001606.1, 1 a.a. - 376 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00000072-P02.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16131221

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 15-06-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues. [provided by RefSeq]

Sequence: MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
Spezifikation

Spezifikation

NP_001606.1
Liquid
72
ACTG2 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACT/ACTA3/ACTE/ACTL3/ACTSG
ACTG2
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
68.3kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ACTG2
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote