missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HMGCS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-54623
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
HMGCS1 Polyclonal specifically detects HMGCS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| HMGCS1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase, 3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble), EC 2.3.3.10, HMG-CoA synthase, HMGCS, hydroxymethylglutaryl-CoA synthase, cytoplasmic, MGC90332 | |
| Rabbit | |
| 57 kDa | |
| 100 μL | |
| Cardiovascular Biology | |
| 3157 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q01581 | |
| HMGCS1 | |
| Synthetic peptides corresponding to HMGCS1(3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)) The peptide sequence was selected from the middle region of HMGCS1. Peptide sequence KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur