missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIV-1 Gag p24 Antibody (7F4), Alexa Fluor™ 750, Novus Biologicals™
Mouse Monoclonal Antibody
Marke: Novus Biologicals NBP2-41339AF750
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
Spezifikation
| HIV-1 Gag p24 | |
| Monoclonal | |
| Alexa Fluor 750 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Virus | |
| Purified |
| Western Blot, ELISA | |
| 7F4 | |
| 50mM Sodium Borate | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 155030 | |
| Store at 4°C in the dark. | |
| IgG1 |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur