missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HERV Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-60024
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
HERV Polyclonal specifically detects HERV in Human samples. It is validated for Western Blot.
Spezifikation
| HERV | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| endogenous retroviral family W, env(C7), member 1, ENV, envelope glycoprotein, Envelope polyprotein gPr73, enverin, Env-W, ENVW, HERV-7q, HERV7Q, HERV-7q Envelope protein, HERV-tryptophan envelope protein, HERV-W, HERV-W Env glycoprotein, HERV-W envelope protein, HERV-W_7q21.2 provirus ancestral Env polyprotein, HERV-W(7q21.1) provirus ancestral Env polyprotein, HERVWENV, HERV-W-ENV, HERVWenvelope protein, human endogenous retrovirus W envC7-1 envelope protein, Syncytin, syncytin A, Syncytin-1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 30816 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UQF0 | |
| ERVW-1 | |
| Synthetic peptides corresponding to ERVWE1(endogenous retroviral family W, env(C7), member 1 (syncytin)) The peptide sequence was selected from the N terminal of ERVWE1. Peptide sequence TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Lowland gorilla: 92%; Pileated gibbon: 85%; Bornean orangutan: 85%; Siamang: 85%; Chimpanzee: 78%;. | |
| Human, Rabbit | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur