missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GTP binding protein era homolog Antibody, Novus Biologicals™

GTP binding protein era homolog Antibody, Novus Biologicals™

Codice prodotto. 18444001 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18444001 25 μL 25µL
18255966 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18444001 Fornitore Novus Biologicals N. del fornitore NBP18970325ul
  • ONLINE EXCLUSIVE PRICE
    526.32 CHF
    451.50 CHF / 25 Mikroliter
    Sparen 74.82 CHF
    14% Rabatt
 Articolo soggetto a restrizioni
Verfügbar ab: 01-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

GTP binding protein era homolog Polyclonal specifically detects GTP binding protein era homolog in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigene GTP binding protein era homolog
Applicazioni Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias gene CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B
Simboli geni ERAL1
Specie ospite Rabbit
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:SVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQY
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 26284
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.