missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GTF2H2 (Human) Recombinant Protein
Human GTF2H2 full-length ORF ( AAH05345, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00002966-P01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
- Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKLVLYIMYN
Spezifikation
| AAH05345 | |
| general transcription factor IIH, polypeptide 2, 44kDa | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GTF2H2 | |
| GST |
| 2966 | |
| Wheat germ expression system | |
| 25 μg | |
| BTF2, BTF2P44, MGC102806, T-BTF2P44, TFIIH | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |