missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCET2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
561.00 CHF
Spezifikation
| Antigen | GCET2 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18237192
|
Novus Biologicals
NBP1-54596 |
100 μL |
561.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
GCET2 Polyclonal specifically detects GCET2 in Human samples. It is validated for Western Blot.Spezifikation
| GCET2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| GAL, GCAT2, germinal center B-cell-expressed transcript 2 protein, germinal center expressed transcript 2, Germinal center-associated lymphoma protein, HGAL, MGC40441 | |
| GCSAM | |
| IgG | |
| 21 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N6F7 | |
| 257144 | |
| Synthetic peptides corresponding to GCET2(germinal center expressed transcript 2) The peptide sequence was selected from the middle region of GCET2. Peptide sequence YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH. | |
| Primary |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts