missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FFAR4/GPR120 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
317.00 CHF - 703.00 CHF
Spezifikation
| Antigen | FFAR4/GPR120 |
|---|---|
| Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18424821
|
Novus Biologicals
NBP1-89739-25ul |
25 μL |
317.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18252478
|
Novus Biologicals
NBP1-89739 |
0.1 mL |
703.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
FFAR4/GPR120 Polyclonal specifically detects FFAR4/GPR120 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| FFAR4/GPR120 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q5NUL3 | |
| 338557 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FRVVPQRLPGADQEISICTLIWPTIPGEISWDV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| G protein-coupled receptor 120, G protein-coupled receptor 129, G protein-coupled receptor PGR4, GPR120, GPR129, G-protein coupled receptor 120, G-protein coupled receptor 129, G-protein coupled receptor GT01, G-protein coupled receptor PGR4, G-protein-coupled receptor GT01, GT01, MGC119984, omega-3 fatty acid receptor 1, PGR4DKFZp686F0824 | |
| FFAR4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title