missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ETF1 (Human) Recombinant Protein
Human ETF1 partial ORF ( NP_004721.1, 338 a.a. - 437 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00002107-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
- Sequence: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Spezifikation
| NP_004721.1 | |
| eukaryotic translation termination factor 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ETF1 | |
| GST |
| 2107 | |
| Wheat germ expression system | |
| 25 μg | |
| D5S1995, ERF, ERF1, MGC111066, RF1, SUP45L1, TB3-1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |