missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ErbB2/Her2 Antibody, R&D Systems™

ErbB2/Her2 Antibody, R&D Systems™

Codice prodotto. 18476140 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18476140 25 μL 25µL
18420501 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18476140 Fornitore Novus Biologicals N. del fornitore NBP18458425ul
 Articolo soggetto a restrizioni
Verfügbar ab: 01-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ErbB2/Her2 Polyclonal specifically detects ErbB2/Her2 in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifica

Antigene ErbB2/Her2
Applicazioni Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulazione PBS (pH 7.2) and 40% Glycerol
Alias gene CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)
Specie ospite Rabbit
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids: LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Metodo di purificazione Immunogen affinity purified
Quantità 25 μL
Status giuridico RUO
Disciplina di ricerca Breast Cancer, Cancer, Cellular Markers, Core ESC Like Genes, Oncogenes, Phospho Specific, Protein Kinase, Stem Cell Markers, Tumor Suppressors
Primario o secondario Primary
ID gene (immissione) 2064
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.