missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAH12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
317.00 CHF - 703.00 CHF
Spezifikation
| Antigen | DNAH12 |
|---|---|
| Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18609205
|
Novus Biologicals
NBP2-38916-25ul |
25 μL |
317.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18163248
|
Novus Biologicals
NBP2-38916 |
0.1 mL |
703.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
DNAH12 Polyclonal specifically detects DNAH12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| DNAH12 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| axonemal beta dynein heavy chain 12, axonemal dynein heavy chain isotype3, axonemal, heavy polypeptide 12, ciliary dynein heavy chain 12, DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, dynein heavy chain 12, axonemal, dynein heavy chain domain-containing protein 2, dynein, axonemal, heavy chain 12, dynein, heavy chain-5, FLJ40427, FLJ44290, HDHC3, HL19, HL-19 | |
| DNAH12 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6ZR08 | |
| 201625 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts