missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DMGDH Antibody, Novus Biologicals™

DMGDH Antibody, Novus Biologicals™

Codice prodotto. 18614427 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
Dimensione della confezione:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18614427 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18614427 Fornitore Novus Biologicals N. del fornitore NBP25801725ul
  • ONLINE EXCLUSIVE PRICE
    517.15 CHF
    443.10 CHF / 25 Mikroliter
    Sparen 74.05 CHF
    14% Rabatt
 Articolo soggetto a restrizioni
Verfügbar ab: 01-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

DMGDH Polyclonal specifically detects DMGDH in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigene DMGDH
Applicazioni Immunocytochemistry, Immunofluorescence
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulazione PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Alias gene dimethylglycine dehydrogenase, dimethylglycine dehydrogenase, mitochondrial, DMGDHD, EC 1.5.99.2, ME2GLYDH
Simboli geni DMGDH
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 29958
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Linea di prodotti Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.