missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DLX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
418.00 CHF - 668.00 CHF
Spezifikation
| Antigen | DLX2 |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18249764
|
Novus Biologicals
NBP2-54963 |
100 μL |
668.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18694586
|
Novus Biologicals
NBP2-54963-25ul |
25 μL |
418.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
DLX2 Polyclonal specifically detects DLX2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| DLX2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 1746 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| distal-less homeo box 2, distal-less homeobox 2, homeobox protein DLX-2, TES1, TES-1 | |
| DLX2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts