missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DDIT3 (Human) Recombinant Protein

Human DDIT3 full-length ORF ( AAH03637.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00001649-P01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16127017

  • 574.00 CHF / 25 Mikrogramm
Verfügbar ab: 09-01-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Spezifikation

Spezifikation

AAH03637.1
DNA-damage-inducible transcript 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DDIT3
GST
1649
Wheat germ expression system
25 μg
CEBPZ, CHOP, CHOP10, GADD153, MGC4154
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote