missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
418.00 CHF - 668.00 CHF
Spezifikation
| Antigen | DDB1 |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18270394
|
Novus Biologicals
NBP2-57877 |
100 μL |
668.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18639196
|
Novus Biologicals
NBP2-57877-25ul |
25 μL |
418.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
DDB1 Polyclonal specifically detects DDB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| DDB1 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Nucleotide Excision Repair | |
| damage-specific DNA binding protein 1 (127kD), damage-specific DNA binding protein 1, 127kDa, Damage-specific DNA-binding protein 1, DDB p127 subunit, DDBa, DNA damage-binding protein 1, DNA damage-binding protein a, HBV X-associated protein 1, UV-damaged DNA-binding factor, UV-damaged DNA-binding protein 1, UV-DDB 1, UV-DDB1, XAP1, XAP-1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE, XPE-BF, XPE-binding factor | |
| DDB1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1642 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts