missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DAAM2 Antibody, R&D Systems™

DAAM2 Antibody, R&D Systems™

Product Code. 18600978 Shop All Bio Techne Products
Change view
Click to view available options
Quantità:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantità Unit Size
18600978 0.1 mL 0.10mL
18629417 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18600978 Supplier Novus Biologicals Supplier No. NBP249141
  • ONLINE EXCLUSIVE PRICE
    704.47 CHF
    664.65 CHF / 0.1 Milliliter
    Sparen 39.82 CHF
    5% Rabatt
 Articolo soggetto a restrizioni
Verfügbar ab: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

DAAM2 Polyclonal antibody specifically detects DAAM2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigene DAAM2
Applicazioni Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulazione PBS (pH 7.2), 40% Glycerol
Alias gene dishevelled associated activator of morphogenesis 2
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDEL
Metodo di purificazione Immunogen affinity purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca Stem Cells
Primario o secondario Primary
ID gene (immissione) 23500
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.