missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CXCL5 Recombinant Protein

Marke:  Abnova™ H00006374-P01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16130622

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 22-06-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Spezifikation

AAH08376
Solution
6374
CXCL5 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CXCL5
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
38.28
8
Glutathione Sepharose 4 Fast Flow
10 ug
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
ENA-78/SCYB5
CXCL5
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote