missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ CSNK1A1L Recombinant Protein

Abnova™ CSNK1A1L Recombinant Protein

Product Code. 16127513
Click to view available options
Menge:
10 μg
25 μg
Unit Size:
10 Mikrogramm
25 Mikrogramm
This item is not returnable. View return policy

Product Code. 16127513

Brand: Abnova™ H00122011P01.10ug

om dit product te kopen Registreer vandaag om een webaccount aan te maken

This item is not returnable. View return policy

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Zugriffsnummer AAH28723
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-ID (Entrez) 122011
Molekulargewicht 62.81
Name CSNK1A1L (Human) Recombinant Protein (P01)
pH-Bereich 8
Vorbereitungsmethode In vitro wheat germ expression system
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 μg
Quelle Wheat Germ (in vitro)
Immunogen MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gen-Alias MGC33182/RP11-532O21.2
Gebräuchliche Bezeichnung CSNK1A1L
Gensymbol CSNK1A1L
Kreuzreaktivität Human
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.