missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ COX7C (Human) Recombinant Protein
Human COX7C full-length ORF ( AAH07498, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00001350-P01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
- Sequence: MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
Spezifikation
| AAH07498 | |
| cytochrome c oxidase subunit VIIc | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 1350 | |
| Wheat germ expression system | |
| 10 μg | |
| COX7C | |
| GST |