missing translation for 'onlineSavingsMsg'
Learn More

CLEC3B Recombinant Protein, Abnova

Brand:  Abnova H00007123-P01.25ug

Additional Details : Gewicht : 0.00010kg

 View more versions of this product

Product Code. 16151462

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
29-06-2020
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH11024
Solution
7123
CLEC3B (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLEC3B
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
47.96
8
Glutathione Sepharose 4 Fast Flow
25 ug
MEVWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNGMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
DKFZp686H17246|TN|TNA
CLEC3B
Wheat Germ (in vitro)
GST
Videos
Documents