CEP57 (19-128) Mouse anti-Human, Clone: 1E9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CEP57.

Marke: Abnova H00009702-M02.100ug

Artikelnummer. 16194012

373.00 CHF
323.54 CHF / 100 Mikrogramm
Sparen 49.46 CHF
13% Rabatt

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).[supplied by OMIM]

Sequence: AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE

Spezifikation

Antigen	CEP57 (19-128)
Klassifikation	Monoclonal
Konjugat	Unconjugated
Zusammensetzung	PBS with no preservative; pH 7.4
Gen-Zugriffsnummer	NM_014679
Gensymbole	CEP57
Immunogen	CEP57 (NP_055494,19 a.a. ∽ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Menge	100 μg
Primär oder sekundär	Primary
Testspezifität	Antibody Reactive Against Recombinant Protein.
Inhalt und Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Purified

Anwendungen	ELISA, Immunofluorescence, Western Blot
Klon	1E9
Beschreibung	Mouse monoclonal antibody raised against a partial recombinant CEP57.
Gen	CEP57
Gen-Alias	KIAA0092/PIG8/TSP57
Wirtsspezies	Mouse
Reinigungsverfahren	Protein A/G purification
Regulatorischer Status	RUO
Gen-ID (Entrez)	9702
Zielspezies	Human
Produkttyp	Antibody
Isotype	IgG1 κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

CEP57 (19-128) Mouse anti-Human, Clone: 1E9, Abnova™

Beschreibung

Spezifikation

Product Suggestions

Documents

Promotions