missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-90052
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CD20 Polyclonal antibody specifically detects CD20 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| CD20 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| B1, B-lymphocyte antigen CD20, B-lymphocyte cell-surface antigen B1, B-lymphocyte surface antigen B1, Bp35MGC3969, CD20 antigen, CD20 receptor, CD20S7, CVID5, LEU-16, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, membrane-spanning 4-domains, subfamily A, member 1, MS4A2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY | |
| 0.1 mL | |
| Adaptive Immunity, B Cell Development and Differentiation Markers, Cancer, Cancer Stem Cells, Cell Biology, Cytokine Research, Immunology, Signal Transduction, Stem Cell Markers, Tumor Biomarkers | |
| 931 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur