missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCL1/I-309/TCA-3 Antibody (4E4), Novus Biologicals™
Mouse Monoclonal Antibody
Marke: Novus Biologicals H00006346-M02
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CCL1/I-309/TCA-3 Monoclonal antibody specifically detects CCL1/I-309/TCA-3 in Human samples. It is validated for ELISA, ELISA
Spezifikation
| CCL1/I-309/TCA-3 | |
| Monoclonal | |
| Unconjugated | |
| NP_002972 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| ELISA, Sandwich ELISA | |
| 4E4 | |
| In 1x PBS, pH 7.4 | |
| C-C motif chemokine 1, chemokine (C-C motif) ligand 1, I-309, inflammatory cytokine I-309, P500, SCYA1Small-inducible cytokine A1, SISe, small inducible cytokine A1 (I-309, homologous to mouse Tca-3), T lymphocyte-secreted protein I-309, TCA3 | |
| CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK | |
| 0.1 mg | |
| Chemokines and Cytokines | |
| 6346 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2b κ |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur