missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CABC1 Antibody, R&D Systems™

CABC1 Antibody, R&D Systems™

Artikelnummer. 18607218 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Quantità:
25 μL
100 μL
Packungsgröße:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantità Packungsgröße
18607218 25 μL 25µL
18260252 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18607218 Lieferant Novus Biologicals Lieferanten-Nr. NBP25600625ul
 Articolo soggetto a restrizioni
Verfügbar ab: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

CABC1 Polyclonal specifically detects CABC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigene CABC1
Applicazioni Immunocytochemistry, Immunofluorescence
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulazione PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias gene aarF domain containing kinase 3, chaperone, ABC1 activity of bc1 complex homolog, chaperone, ABC1 activity of bc1 complex homolog (S. pombe), chaperone, ABC1 activity of bc1 complex like (S. pombe), chaperone-ABC1 (activity of bc1 complex, S.pombe)-like, Chaperone-ABC1-like, coenzyme Q8 homolog, EC 2.7.11, EC 2.7.11.-, MGC4849, mitochondrial, SCAR9
Simboli geni COQ8A
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAG
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Disciplina di ricerca Apoptosis, Protein Kinase
Primario o secondario Primary
ID gene (immissione) 56997
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Linea di prodotti Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.