missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DAAM2 Antibody, R&D Systems™

DAAM2 Antibody, R&D Systems™

Codice prodotto. 18600978 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18600978 0.1 mL 0.10mL
18629417 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18600978 Fornitore Novus Biologicals N. del fornitore NBP249141
  • ONLINE EXCLUSIVE PRICE
    704.47 CHF
    664.65 CHF / 0.1 Milliliter
    Sparen 39.82 CHF
    5% Rabatt
 Articolo soggetto a restrizioni
Verfügbar ab: 01-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

DAAM2 Polyclonal antibody specifically detects DAAM2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifica

Antigene DAAM2
Applicazioni Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulazione PBS (pH 7.2), 40% Glycerol
Alias gene dishevelled associated activator of morphogenesis 2
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDEL
Metodo di purificazione Immunogen affinity purified
Quantità 0.1 mL
Status giuridico RUO
Disciplina di ricerca Stem Cells
Primario o secondario Primary
ID gene (immissione) 23500
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.