missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TEX44 Antibody, R&D Systems™

TEX44 Antibody, R&D Systems™

Codice prodotto. 18620347 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
0.1 mL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18620347 0.1 mL 0.10mL
18619286 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18620347 Fornitore Novus Biologicals N. del fornitore NBP249226
  • ONLINE EXCLUSIVE PRICE
    704.47 CHF
    664.65 CHF / 0.1 Milliliter
    Sparen 39.82 CHF
    5% Rabatt
 Articolo soggetto a restrizioni
Verfügbar ab: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

TEX44 Polyclonal antibody specifically detects TEX44 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifica

Antigene TEX44
Applicazioni Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulazione PBS (pH 7.2), 40% Glycerol
Alias gene C2orf57, chromosome 2 open reading frame 57, testis-expressed protein 44, uncharacterized protein C2orf57
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to amino acids: SHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQHMEAQPVESDADHVTAGANGQHGPQAASTTKSAEEKAEHP
Metodo di purificazione Immunogen affinity purified
Quantità 0.1 mL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 165100
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Forma Purified
Isotype IgG
Linea di prodotti Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.