missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ BBP Recombinant Protein

Abnova™ BBP Recombinant Protein

Artikelnummer. p-3717607
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16125563

Marke: Abnova™ H00083941P01.10ug

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Zugriffsnummer AAH29486.1
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-ID (Entrez) 83941
Molekulargewicht 44.88
Name BBP (Human) Recombinant Protein (P01)
pH-Bereich 8
Vorbereitungsmethode In vitro wheat germ expression system
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 μg
Quelle Wheat Germ (in vitro)
Immunogen WGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gen-Alias BBP
Gebräuchliche Bezeichnung TM2D1
Gensymbol TM2D1
Kreuzreaktivität Human
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Form Solution
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.