missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 18614497

ARSJ Antibody, R&D Systems™

Code produit 18614497 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité Unit Size
18614497 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18614497 Supplier Novus Biologicals Supplier No. NBP248658
  • ONLINE EXCLUSIVE PRICE
    703.45 CHF
    607.95 CHF / 0.1 Milliliter
    Sparen 95.50 CHF
    13% Rabatt
 Article restreint
Verfügbar ab: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ARSJ Polyclonal antibody specifically detects ARSJ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigène ARSJ
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formule PBS (pH 7.2) and 40% Glycerol
Alias de gène arylsulfatase family, member J, arylsulfatase J, ASJ, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.12, FLJ23548
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Méthode de purification Immunogen affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Lipid and Metabolism
Primaire ou secondaire Primary
Identification génétique (Entrez) 79642
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type de produit Antibody
Forme Purified
Isotype IgG
Gamme de produits Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.